DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and Psmc4

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_476463.1 Gene:Psmc4 / 117262 RGDID:621102 Length:418 Species:Rattus norvegicus


Alignment Length:427 Identity:167/427 - (39%)
Similarity:251/427 - (58%) Gaps:44/427 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIRITHEIQAQNEKIKDN----------- 65
            :.|...||.|...:  :::.||.:.:..|::.           ::.|.|.|||.           
  Rat    24 QTGLSFLGPEPEDL--EDLYSRYKKLQQELEF-----------LEVQEEYIKDEQKNLKKEFLHA 75

  Fly    66 TEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVD 130
            .|::|..:::|.::...:|.:|.:                    .|::.::|...|::.::..:|
  Rat    76 QEEVKRIQSIPLVIGQFLEAVDQN--------------------TAIVGSTTGSNYYVRILSTID 120

  Fly   131 AEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPM 195
            .|.|||...|.::|.|..:::.||.|.|:.:..:..|::|...|:||||:|.|.||:.|||.||:
  Rat   121 RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPL 185

  Fly   196 THKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDA 260
            ||.|.:|.:||.||:|||:|||||.|||:||:|.|..|.:.|:::.|.:.||.::|:|.::|||.
  Rat   186 THFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDV 250

  Fly   261 FALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVD 325
            |.||||.|||||||||:|||.|||||::...||||||.:||||||:|||....::|||.||||.|
  Rat   251 FRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRAD 315

  Fly   326 ILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCV 390
            .|||||||.||||||||||.|:...:..|....:.|||:|.:|:.|:.....|..:||...::|.
  Rat   316 TLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQ 380

  Fly   391 EAGMIALRRSANSVTHEDFMDAIMEVQAKKKANLNYY 427
            |:||:|:|.:...|..:||..|...|..|.:....:|
  Rat   381 ESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 161/398 (40%)
Psmc4NP_476463.1 PTZ00454 34..418 CDD:240423 163/417 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.