DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBP3 and RGPD6

DIOPT Version :9

Sequence 1:NP_651178.1 Gene:RanBP3 / 42804 FlyBaseID:FBgn0039110 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_016860328.1 Gene:RGPD6 / 729540 HGNCID:32419 Length:1811 Species:Homo sapiens


Alignment Length:434 Identity:87/434 - (20%)
Similarity:160/434 - (36%) Gaps:78/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FRGGFTLKASRLGGAVLRPAVLANSSGSNNS--------STSPSAGEDSALLNNPFLRESKDDDD 70
            ::|..|...:.|..|...|:|..:.|.:.||        :.:|:.|..    |..|  :|..:..
Human   884 YQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSS----NTEF--KSTKEGF 942

  Fly    71 DEEVVATG-SAAAESTGDKEDDDVDERPDPLTKLRSNGIERSSMFAAAKNNMPNVQSSGFVFGQN 134
            ...|.|.| .......|::|            |.|...:|..:.| .|::.....:..|.:||| 
Human   943 SIPVSADGFKFGISEPGNQE------------KKREKPLENDTGF-QAQDISGRKKGRGVIFGQ- 993

  Fly   135 VHERVVAPNAEQVTAEPDADTAASSVSAQEAASSSTAATSSSAPLLFSSVIQNAAQTTETSEAAA 199
                                |:::...|..|.|:|..........|.......|.:...:|....
Human   994 --------------------TSSTFTFADVAKSTSGEGFQFGKKDLNFKGFSGAGEKLFSSRYGK 1038

  Fly   200 SSSICSSSSNNKESAEAKSLTDVAREYEESRAQKRKYEEVETFTGEEDEINIIDVSCKLFAFLNS 264
            .::..::|.:.::..:|....|....:.|...|..  |:||..||||.|..:.....|||.|...
Human  1039 MANKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMP--EKVELVTGEEGEKVLYSQGVKLFRFDAE 1101

  Fly   265 --NWEERGRGSLRLNDAKDLRGDSRVVFRTSGNLRLLLNTKVWAAMVAE--RASQKSLRLTAID- 324
              .|:|||.|:|::. ..::.|..|::.|....|::..|..:...|..:  ..|.::...:|.| 
Human  1102 VRQWKERGLGNLKIL-KNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWSASDF 1165

  Fly   325 NSGVVKI--FLAMGRPADIAQLHKALSERIAKRKVSHPEEC---------------SVEEAKNGV 372
            :.|..|:  ..|..:..::|:..|...|...:..:..|.:.               ..||.|:|:
Human  1166 SDGDAKLERLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGL 1230

  Fly   373 ASEAAASLQPESTTHDDEDEDAAPGPSGA----ISAEADSYGPS 412
            ..........::...::|::.:..|.:||    |...|::.||:
Human  1231 KDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNAENTGPT 1274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBP3NP_651178.1 RanBD_RanBP3 243..352 CDD:270001 30/115 (26%)
RGPD6XP_016860328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.