DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBP3 and nup61

DIOPT Version :9

Sequence 1:NP_651178.1 Gene:RanBP3 / 42804 FlyBaseID:FBgn0039110 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_587937.2 Gene:nup61 / 2539348 PomBaseID:SPCC18B5.07c Length:549 Species:Schizosaccharomyces pombe


Alignment Length:400 Identity:96/400 - (24%)
Similarity:161/400 - (40%) Gaps:97/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASRLGGAVLRPAVLANSSGSNNSSTSP--SAGEDSALLNNPFLRESKDDDDDEEVVATGSAAAES 84
            |.|.|.:.  || |.:|...|:|:.:|  |.||.||.     ..|:|:.:......|||:||..:
pombe   186 APRFGFSA--PA-LGSSFQFNSSAFTPKGSFGEKSAT-----EAEAKEKETSSNQTATGTAATTT 242

  Fly    85 T-------------GDKEDDDVDERPDPLTKLRSNGIERSSMFAA-------------AKNNMP- 122
            .             ..||    :|...|||.:.|.....:|..|:             ::.:.| 
pombe   243 NQFSFNTAANPFAFAKKE----NEESKPLTPVFSFSTTMASADASKETKQTHETKDSKSEESKPS 303

  Fly   123 NVQSSGFVFGQNVHERVVAP---NAEQVTAEPDAD----------TAASSVSAQEAASSSTAATS 174
            |.:.|         |..|.|   |....:..||..          |..:.:|:::..:||.....
pombe   304 NNEKS---------ENAVEPAKGNTMSFSWTPDKPIKFDTPEKKFTFTNPLSSKKLPASSDVKPP 359

  Fly   175 SSAPLLFSSVIQNAAQTTETSEAAASSSICSSSSNNKESAEAKSLTDVAREYEESRAQKRKYEEV 239
            |:|.:.||.    ...|...|.||..||..:||:.....||        :..|.|...|.:.||.
pombe   360 SAAAVGFSF----GTTTNPFSFAAPKSSFPTSSTPASVGAE--------KSEETSNGNKSEQEEK 412

  Fly   240 ETFT---------------GEEDEINIIDVSCKLFAF--LNSNWEERGRGSLRLNDAKDLRGDSR 287
            |...               |||:|.::.:...|::.|  .:.::.:.|.|.|::|..:| .|.:|
pombe   413 ENGNDETRSNDSLVSGKGKGEENEDSVFETRAKIYRFDATSKSYSDIGIGPLKINVDRD-TGSAR 476

  Fly   288 VVFRTSGNLRLLLNTKVWAAMVAERASQKSLRLTAIDNSG-VVKIFLAMGRPADIAQLHKALSER 351
            ::.|..|:.:||||.::........|.:|.:::.|....| .::::|...:....|:  |.|:| 
pombe   477 ILARVEGSGKLLLNVRLCQDFEYSLAGKKDVKVPAASTDGKSIEMYLIRVKEPSTAE--KLLAE- 538

  Fly   352 IAKRKVSHPE 361
            :.::|||..|
pombe   539 LNEKKVSKSE 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBP3NP_651178.1 RanBD_RanBP3 243..352 CDD:270001 28/126 (22%)
nup61NP_587937.2 NUP50 3..63 CDD:286055
RanBD_NUP50 431..543 CDD:269991 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3882
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.