DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and GCG1

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_011090.3 Gene:GCG1 / 856910 SGDID:S000000965 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:74/248 - (29%)
Similarity:99/248 - (39%) Gaps:74/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NNNAGPSDPACWVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLV-- 109
            |:|:|     .||.|||||.:.|..:||..|...|.|:.|||||.:..|||....|||||||:  
Yeast     3 NDNSG-----IWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPY 62

  Fly   110 ED-----------------------KEGITWGCAYRITGSTA---LDYLKQRECTLGGYATIDTK 148
            ||                       .:.:|.|..|.|....|   .:||..||  ..||...:.:
Yeast    63 EDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVRE--QNGYTLHEVE 125

  Fly   149 FFPRVASQDTPFSGEAVEVL--------------VYVATPENIYWLGDDPVEEIAQQIVSCRGPS 199
            .......:.....|||:|.|              ||:.|.:|..::|.:.|:|.|:.|....|||
Yeast   126 VHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETAKVIAVSHGPS 190

  Fly   200 GHNAEYLLRLALFMHEEIPGVRDDHLFELEQLVLEELYRRQIPLSSVMGRNPD 252
            |.|.|||.:                   |||.:      .|:|:....||..|
Yeast   191 GSNYEYLAK-------------------LEQAL------AQMPIMKERGRITD 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 63/208 (30%)
GCG1NP_011090.3 ChaC 8..231 CDD:398428 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344008
Domainoid 1 1.000 93 1.000 Domainoid score I1701
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm46843
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.