DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and AT1G44790

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_564490.1 Gene:AT1G44790 / 841043 AraportID:AT1G44790 Length:199 Species:Arabidopsis thaliana


Alignment Length:208 Identity:77/208 - (37%)
Similarity:107/208 - (51%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ACWVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEGITWGCA 120
            |.||||||||.|..||.:.:.:.|:|:||.|.|.||:..|||..:.|||..||....|.:..|.|
plant     2 AMWVFGYGSLIWKTGFPFDESLPGFIKGYRRVFHQGSTDHRGTPDFPGRTVTLEAAHEEVCCGVA 66

  Fly   121 YRITGS----TALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPE---NIY 178
            |:||..    .||.:|:.||........:|  ||....:.:...:|    |:||:|:|:   |..
plant    67 YKITKEEDKRDALLHLEVREKQYDQKEYLD--FFTDSNASEPAVAG----VMVYIASPDKKSNNN 125

  Fly   179 WLGDDPVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEI---PGVRDDHLFELEQLV---LEELY 237
            :||..|:|:||:|||..:||||.|.:||..|     ||.   .|.:|.|:.:|...|   |.|..
plant   126 YLGPAPLEDIAKQIVKAKGPSGPNRDYLFNL-----EEALAQLGFKDKHVTDLANQVRHILSESE 185

  Fly   238 RRQIPLSSVMGRN 250
            ...|..::....|
plant   186 ELDIDATAATANN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 69/176 (39%)
AT1G44790NP_564490.1 ChaC 3..178 CDD:282590 71/185 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm3368
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.