DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and AT5G26220

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_197994.1 Gene:AT5G26220 / 832691 AraportID:AT5G26220 Length:216 Species:Arabidopsis thaliana


Alignment Length:210 Identity:74/210 - (35%)
Similarity:112/210 - (53%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEGITWGCAYR 122
            ||||||||.|:|||::.:.:.|||:.|.|.|....:.|||..|.|.|..||.:....|.||.||.
plant     4 WVFGYGSLIWNPGFDFDEKLIGYIKDYKRVFDLACIDHRGTPEHPARTCTLEQSTGAICWGAAYC 68

  Fly   123 ITG-----STALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPE---NIYW 179
            :.|     ..|::||::|||      ..|:|......:::...:.....|:|:.:||:   |.|:
plant    69 VRGGPEKEKLAMEYLERREC------EYDSKTLVEFYTENDTSTPIVTGVIVFTSTPDKVSNKYY 127

  Fly   180 LGDDPVEEIAQQIVSCRGPSGHNAEYLLRL--ALF--MHEEIPGVRDDHLFELEQLVLEELYRRQ 240
            ||..|:||:|:||.:..||.|:|.|||.:|  |:|  .|||      :::.||...|     |:|
plant   128 LGPAPLEEMARQIATASGPCGNNREYLFKLEKAMFDIEHEE------EYVIELANEV-----RKQ 181

  Fly   241 IPLSSVMGRNPDRIR 255
            :.|       |:.::
plant   182 LDL-------PEEVK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 67/177 (38%)
AT5G26220NP_197994.1 GGCT_like 3..181 CDD:419880 71/193 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1721
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H92858
Inparanoid 1 1.050 129 1.000 Inparanoid score I1893
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm3368
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.