DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and Chac1

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_081205.1 Gene:Chac1 / 69065 MGIID:1916315 Length:223 Species:Mus musculus


Alignment Length:179 Identity:96/179 - (53%)
Similarity:118/179 - (65%) Gaps:10/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GPSDP-ACWVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEG 114
            |..|| |.|:||||||.|.|.|.|:....|::|||.||||||:..|||.::.||||.||:||:||
Mouse    27 GDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDREG 91

  Fly   115 ITWGCAYRITG---STALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPEN 176
            .|||.||::.|   :.||.||..||..||||.|.:..|:|    ||||  .:.:..|.|||||:|
Mouse    92 CTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVTFYP----QDTP--DQPLTALAYVATPQN 150

  Fly   177 IYWLGDDPVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHL 225
            ..:||..|.|.||.||::|||.||||.|||||||.||....|..:|:||
Mouse   151 PGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 90/169 (53%)
Chac1NP_081205.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
ChaC 34..209 CDD:282590 92/172 (53%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 36..41 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837889
Domainoid 1 1.000 181 1.000 Domainoid score I3475
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3933
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49032
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - oto94063
orthoMCL 1 0.900 - - OOG6_101165
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.690

Return to query results.
Submit another query.