DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and chac1

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001103596.2 Gene:chac1 / 563855 ZFINID:ZDB-GENE-030131-1957 Length:196 Species:Danio rerio


Alignment Length:199 Identity:98/199 - (49%)
Similarity:121/199 - (60%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AGPSDPACWVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEG 114
            ||.|  :.|:||||||.|.|.|.|.:...|||:||.||||.|:..|||.:|.||||.||:|:.:.
Zfish     8 AGKS--SLWIFGYGSLVWKPDFKYKRSKVGYIKGYKRRFWHGDNFHRGDDEMPGRVVTLIEEDDV 70

  Fly   115 ITWGCAYRITGS---TALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPEN 176
            .|||.|:.:|||   .:|.||..||...|||.|....||||..:|      ..|:.|||:|||:|
Zfish    71 CTWGVAFEVTGSQMEESLKYLNVREAVRGGYLTRAVDFFPRGTNQ------PPVQALVYIATPDN 129

  Fly   177 IYWLGDDPVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLVLEELYRRQI 241
            ..:||....||||.||..|:|.||||.|||||||.||....|.|.|.|||.:|..:|..:  |.|
Zfish   130 PIYLGPASTEEIASQIAVCKGNSGHNIEYLLRLAEFMRVSCPDVDDPHLFSIEAALLATI--RPI 192

  Fly   242 PLSS 245
            .|::
Zfish   193 LLAA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 87/169 (51%)
chac1NP_001103596.2 ChaC 5..190 CDD:226226 95/191 (50%)
ChaC 13..183 CDD:282590 90/175 (51%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 15..20 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581680
Domainoid 1 1.000 181 1.000 Domainoid score I3432
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3953
OMA 1 1.010 - - QHG49032
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm26491
orthoMCL 1 0.900 - - OOG6_101165
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.