DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and chac2

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001025128.1 Gene:chac2 / 557614 ZFINID:ZDB-GENE-050706-146 Length:182 Species:Danio rerio


Alignment Length:183 Identity:83/183 - (45%)
Similarity:106/183 - (57%) Gaps:12/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEGITWGCAYR 122
            ||||||||.|...|.|.....|:::|:.||||||:..|||...|||||.||:||.||..||.||:
Zfish     2 WVFGYGSLIWKVDFPYEDKRVGFVKGFSRRFWQGSTDHRGVPGKPGRVVTLIEDPEGCVWGVAYK 66

  Fly   123 ITG---STALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPENIYWLGDDP 184
            :..   ....:||..||  .|||..|...|.|: ..|..|..    :.|:|:.:.:|..:||..|
Zfish    67 LPSGQEQEVKEYLDYRE--KGGYGVITVTFHPK-DEQQQPMQ----DTLLYIGSCDNPNYLGPAP 124

  Fly   185 VEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLV--LEE 235
            :|.||||||...||||.|.:||..||..:.:.:|...|||||.||:||  |:|
Zfish   125 LETIAQQIVKSVGPSGKNTDYLFELADALRQLVPEDLDDHLFSLERLVKQLQE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 73/168 (43%)
chac2NP_001025128.1 ChaC 1..175 CDD:282590 81/179 (45%)
ChaC 2..178 CDD:226226 83/183 (45%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 3..8 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm26491
orthoMCL 1 0.900 - - OOG6_101165
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.