DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and chac2

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001017137.1 Gene:chac2 / 549891 XenbaseID:XB-GENE-5817326 Length:184 Species:Xenopus tropicalis


Alignment Length:186 Identity:89/186 - (47%)
Similarity:111/186 - (59%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEGITWGCAYR 122
            ||||||||.|...|.|.:.:.|||..|.||||||:..|||...|||||.|||||.||..||.|||
 Frog     2 WVFGYGSLIWKVDFPYVEKLVGYITCYSRRFWQGSTDHRGVPGKPGRVVTLVEDPEGCVWGVAYR 66

  Fly   123 ITGSTALD---YLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPENIYWLGDDP 184
            :......:   ||..||  .|||.|....|:|:..| ..||:     ||:|:.|.:|..:||..|
 Frog    67 LPEGKEEEVKAYLDFRE--KGGYRTSTGVFYPKDPS-IKPFN-----VLLYIGTCDNPDYLGPAP 123

  Fly   185 VEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLV--LEELYR 238
            :|:||:||::..||||.|.|||..||..:...:|...|:|||.||:||  |.|.:|
 Frog   124 LEDIAEQILNAVGPSGRNTEYLFELANSLRNLVPEDADEHLFSLERLVRQLLEAHR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 79/168 (47%)
chac2NP_001017137.1 ChaC 1..174 CDD:368097 86/179 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4229
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.