DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and CHAC2

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001008708.1 Gene:CHAC2 / 494143 HGNCID:32363 Length:184 Species:Homo sapiens


Alignment Length:186 Identity:88/186 - (47%)
Similarity:108/186 - (58%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEGITWGCAYR 122
            ||||||||.|...|.|...:.|||..|.||||||:..|||...|||||.|||||..|..||.|||
Human     2 WVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYR 66

  Fly   123 ITGSTALD---YLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPENIYWLGDDP 184
            :......:   ||..||  .|||.|....|:|:..: ..|||     ||:|:.|.:|..:||..|
Human    67 LPVGKEEEVKAYLDFRE--KGGYRTTTVIFYPKDPT-TKPFS-----VLLYIGTCDNPDYLGPAP 123

  Fly   185 VEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLVLEELYRRQ 240
            :|:||:||.:..||||.|.|||..||..:...:|...|:|||.||:||.|.|..:|
Human   124 LEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 78/168 (46%)
CHAC2NP_001008708.1 ChaC 1..174 CDD:368097 85/179 (47%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 3..8 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101165
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.