DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and Chac1

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001166908.1 Gene:Chac1 / 362196 RGDID:1307153 Length:222 Species:Rattus norvegicus


Alignment Length:209 Identity:104/209 - (49%)
Similarity:129/209 - (61%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NAGPS----DP-ACWVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATL 108
            :|.||    || |.|:||||||.|.|.|.|:....|::|||.||||||:..|||.::.||||.||
  Rat    20 SAQPSWEDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTL 84

  Fly   109 VEDKEGITWGCAYRITG---STALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVY 170
            :||.||.|||.||::.|   |.||.||..||..||||.|.:..|:|    ||||  .:.:..|.|
  Rat    85 LEDHEGCTWGVAYQVRGEQVSEALKYLNVREAVLGGYDTKEVTFYP----QDTP--DQPLTALAY 143

  Fly   171 VATPENIYWLGDDPVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLV--- 232
            ||||:|..:||..|.|.||.||::|||.||||.|||||||.||....|..:|:||..:...|   
  Rat   144 VATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLEAIVDAVGSL 208

  Fly   233 LEELYRRQIPLSSV 246
            |...|..:.||:.:
  Rat   209 LPCSYLSEQPLALI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 91/169 (54%)
Chac1NP_001166908.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 2/4 (50%)
ChaC 33..208 CDD:398428 94/180 (52%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 35..40 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341666
Domainoid 1 1.000 181 1.000 Domainoid score I3391
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I3858
OMA 1 1.010 - - QHG49032
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - oto97588
orthoMCL 1 0.900 - - OOG6_101165
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.670

Return to query results.
Submit another query.