DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and SPBC31F10.03

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_596565.1 Gene:SPBC31F10.03 / 2540372 PomBaseID:SPBC31F10.03 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:70/201 - (34%)
Similarity:98/201 - (48%) Gaps:30/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKE-------GI 115
            ||||||||.|||..:|...|..:|:|||||||..:..|||....||.|.||:..:|       ..
pombe    11 WVFGYGSLIWHPPPHYDYSIPCFIKGYVRRFWMRSEDHRGTVNSPGLVLTLIPYEEWKQFSDWSF 75

  Fly   116 T------WGCAYRITGSTAL---DYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEV---- 167
            |      ||.|:||....|.   :||..||  :.||.......:..        :|:.:.|    
pombe    76 TPFDEGCWGMAFRIPAKYATQVREYLDDRE--VNGYTAHSVPVYAH--------TGDEIPVLENC 130

  Fly   168 LVYVATPENIYWLGDDPVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLV 232
            ||||.|.::..:...|.:.::|:.|.:.||.||.|..||..||..:....|..:|.|:||||..|
pombe   131 LVYVGTSKSPQFQPSDDLTQMAKIISTRRGKSGDNFVYLFELAKCLRHLSPESKDIHVFELEAEV 195

  Fly   233 LEELYR 238
            .:::.:
pombe   196 RKQMQK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 64/185 (35%)
SPBC31F10.03NP_596565.1 ChaC 1..203 CDD:226226 70/201 (35%)
ChaC 10..198 CDD:282590 70/196 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1782
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I1644
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm47298
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.