DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10365 and F22F7.7

DIOPT Version :9

Sequence 1:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_503578.1 Gene:F22F7.7 / 178693 WormBaseID:WBGene00017724 Length:232 Species:Caenorhabditis elegans


Alignment Length:179 Identity:76/179 - (42%)
Similarity:105/179 - (58%) Gaps:8/179 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKEGITWGCAYR 122
            |:||||||.|:|||.::.....|..|:.||.:|||..|||.|:.|||||||:|:....|.|..:|
 Worm    51 WIFGYGSLIWNPGFTFSTSRKAYAIGWARRMYQGNTYHRGDEKLPGRVATLIEETNSYTNGVVFR 115

  Fly   123 ITG----STALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSGEAVEVLVYVATPENIYWLGDD 183
            :.|    :||:.||:||||. .|||........|.|:...|   ..|..|..||..:|..:||.|
 Worm   116 VDGKSAIATAVKYLEQRECD-NGYAFRMVPVQIRSAAHRRP---TVVMALTCVADQQNELYLGPD 176

  Fly   184 PVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFELEQLV 232
            .:.::|::||:.:|.:|.|.||:|.||..:.:..|...|||||:||..|
 Worm   177 DLIKMAREIVTAKGCAGPNCEYVLNLAENLRKLFPNDEDDHLFQLEHHV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10365NP_651176.1 ChaC 57..224 CDD:282590 69/169 (41%)
F22F7.7NP_503578.1 ChaC 50..230 CDD:226226 76/179 (42%)
ChaC 50..228 CDD:282590 76/179 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159774
Domainoid 1 1.000 136 1.000 Domainoid score I3074
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I3137
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49032
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - oto17648
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.