DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG11313

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:357 Identity:117/357 - (32%)
Similarity:165/357 - (46%) Gaps:41/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PKQEFPDCPADEKCIRLDKCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYICC-PEP---- 240
            |.|....|.....|:.|:..|...|.|..:...:.::| |.:.    |.....::|| |:.    
  Fly    27 PNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESR-CLVS----DQSDLPFVCCTPDTDYNT 86

  Fly   241 -----------GNVLP--TSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSL 292
                       ..:||  :.||......::..|......|:.||.:|.|.......:...|:|||
  Fly    87 TRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSL 151

  Fly   293 INKRYVLTAAHCV-VKDKMVNTDLVLR-RVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHE 355
            ||.|||:|||||| ...:....|:..| .||||||:.:...|| ..|.|....|:|.:|...:||
  Fly   152 INNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDC-LNGRCLPEPVQIAVEEIRIHE 215

  Fly   356 QYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHN----HPLQIAGWGYTKNREYSQVL 416
            . |.|..|.:||||:||...|.|:..|.|:|:| ..:.|.|    ....:||||.|...|.|.|.
  Fly   216 S-FGTRLFWNDIALIRLAREVAYSPSIRPVCLP-STVGLQNWQSGQAFTVAGWGRTLTSESSPVK 278

  Fly   417 LH-NTVYENRYYCQDKIS--FFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIV 478
            :. ...|.....|:.|.:  ....:|.:||.|....|||:||||||||..    ::.:..|.|||
  Fly   279 MKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAF----HEGVWVLGGIV 339

  Fly   479 SYGSENCGDR-KPGVYTKTGAFFSWIKANLKP 509
            |:|. |||.| .|.|||...::.:||..|::|
  Fly   340 SFGL-NCGSRFWPAVYTNVLSYETWITQNIRP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 97/255 (38%)
Tryp_SPc 260..503 CDD:214473 95/252 (38%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/55 (20%)
Tryp_SPc 116..367 CDD:238113 97/258 (38%)
Tryp_SPc 116..364 CDD:214473 95/255 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.