DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:288 Identity:74/288 - (25%)
Similarity:117/288 - (40%) Gaps:62/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PEP-GNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN--CSGSLINKRYVL 299
            |.| ..::||.........|:..|..|...:.|::..|::..      ..|  |.||:|...:||
  Fly    18 PTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSG------NGNWWCGGSIIGNTWVL 76

  Fly   300 TAAHCV--VKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSR 362
            |||||.  .....:|....||......|.:.       :||    ||:        |..| |:..
  Fly    77 TAAHCTNGASGVTINYGASLRNQPQYTHWVG-------SGN----FVQ--------HHHY-NSGN 121

  Fly   363 FESDIALVRLQTP-VRYTHEILPICVPKDPIPLHNHPLQ--------IAGWGYTKN----REYSQ 414
            ..:||:|:|  || |.:.|     .|.|..:|.:|...|        .:|||.|.:    .::.|
  Fly   122 LHNDISLIR--TPHVDFWH-----LVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQ 179

  Fly   415 VLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVS 479
            .:  :....::..|....|.  :::.||.:...|:.:|.|||||||:....|      .|.|:.|
  Fly   180 AV--DVQIMSQSDCSRTWSL--HDNMICINTNGGKSTCGGDSGGPLVTHEGN------RLVGVTS 234

  Fly   480 Y-GSENCGDRKPGVYTKTGAFFSWIKAN 506
            : .|..|....|.|:::...:..||:.|
  Fly   235 FVSSAGCQSGAPAVFSRVTGYLDWIRDN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 68/263 (26%)
Tryp_SPc 260..503 CDD:214473 66/260 (25%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 67/264 (25%)
Tryp_SPc 38..262 CDD:238113 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.