DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG9737

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:394 Identity:118/394 - (29%)
Similarity:181/394 - (45%) Gaps:93/394 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DCPADEK---CIRLDKC---LRIHNTT--MEDGANLMDNRQCAIDTRRIDSDKRHY---ICCPEP 240
            |.|.:.|   |:.:.:|   |::.|.|  ..:..|.:...||.:: :::...:..|   :|||..
  Fly    29 DIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVE-QQVSEAQGSYESLVCCPAN 92

  Fly   241 G-----------------------------------NVLPTS-------CGQAPPLYRMAYGTAA 263
            |                                   .|.|:|       ||: ....|:..|..|
  Fly    93 GQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECGK-QVTNRIYGGEIA 156

  Fly   264 RPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCV----VKDKMVNTDLVLRRVRLGE 324
            ..:|:||:|:|:|.:.     ...|||:||:.|::|||||||    |:|:.     .|:.|||||
  Fly   157 ELDEFPWLALLVYNSN-----DYGCSGALIDDRHILTAAHCVQGEGVRDRQ-----GLKHVRLGE 211

  Fly   325 HDITTNPDCDFTGN---CAAPFVEIGIEYFNVHEQYFNTSRFE-SDIALVRLQTPVRYTHEILPI 385
            .::.|.|||....|   ||...::|..|..:||.:|...|.:: :|||::||:.||.:||.::||
  Fly   212 FNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPI 276

  Fly   386 CVPKDPIPL---HNHPLQIAGWGYTK--NREYSQVLLHNTV-------YENRYYCQDKISFF--- 435
            |:|....||   ......::|||.|.  |:.:  :.:|:.:       |.:...|...:..|   
  Fly   277 CLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYF--INIHSPIKLKLRIPYVSNENCTKILEGFGVR 339

  Fly   436 RNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCG-DRKPGVYTKTGAF 499
            ....||||.|...:|:|.||||||||.......:.:.|  |:||||...|| ..||.|||....:
  Fly   340 LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAY--GVVSYGFTQCGMAGKPAVYTNVAEY 402

  Fly   500 FSWI 503
            ..||
  Fly   403 TDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 96/268 (36%)
Tryp_SPc 260..503 CDD:214473 94/266 (35%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 12/60 (20%)
Tryp_SPc 149..406 CDD:214473 95/270 (35%)
Tryp_SPc 150..409 CDD:238113 96/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.