DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:106/271 - (39%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNN--CSGSLINKRYVLTAAHCVVKDKMVNTDLVLR 318
            |:..|..|...:.|::..|::..      ..|  |.||:|...:|||||||              
  Fly    35 RITNGYPAYEGKVPYIVGLLFSG------NGNWWCGGSIIGNTWVLTAAHC-------------- 79

  Fly   319 RVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFN-------VHEQYFNTSRFESDIALVRLQTPV 376
                      ||.....|.|..|. :....:|.:       :...::|:....:||:|:|  || 
  Fly    80 ----------TNGASGVTINYGAS-IRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR--TP- 130

  Fly   377 RYTHEILPICVPKDPIPLHNHPLQ--------IAGWGYTKNREYSQVLLHNTVYE--NRYYCQDK 431
               |......|.|..:|.:|...|        .:|||.|.:.......|.:...:  ::..|...
  Fly   131 ---HVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT 192

  Fly   432 ISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS-ENCGDRKPGVYTK 495
            .|.  :::.||.:...|:.:|.|||||||:....|      .|.|:.|:|| ..|....|.|:::
  Fly   193 WSL--HDNMICINTDGGKSTCGGDSGGPLVTHDGN------RLVGVTSFGSAAGCQSGAPAVFSR 249

  Fly   496 TGAFFSWIKAN 506
            ...:..||:.|
  Fly   250 VTGYLDWIRDN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 64/265 (24%)
Tryp_SPc 260..503 CDD:214473 62/262 (24%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 64/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.