DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG11843

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:356 Identity:100/356 - (28%)
Similarity:148/356 - (41%) Gaps:76/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 INTYCCPKQEFPDCPADEKCIRLDKCL---RIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYIC 236
            |.:..|...:.||......|.|..|.:   ||....:..||        :|::|.||        
  Fly    11 IVSLACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGA--------SIESRIID-------- 59

  Fly   237 CPEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN---CSGSLINKRYV 298
                      :|....||  :..|..|:|.|:|.||.|   .||....:..   |.|.||::|:|
  Fly    60 ----------NCRSYTPL--IVGGHPAQPREFPHMARL---GRRPDPSSRADWFCGGVLISERFV 109

  Fly   299 LTAAHCVVKDK-MVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAP--FVEIGIEYFNVHEQYFNT 360
            ||||||:..:: .||.      |||||.|.      |.....|||  ::..|   :..|..| ..
  Fly   110 LTAAHCLESERGEVNV------VRLGELDF------DSLDEDAAPRDYMVAG---YIAHPGY-ED 158

  Fly   361 SRFESDIALVRLQTPV---RYTHEILPICVPKDPIPLHNHPLQIAGWGYT--KNREYSQVLLHNT 420
            .:|..||.||:|...|   .|.|   |.|:|.......:..:.: |||.|  ..:..:|:|....
  Fly   159 PQFYHDIGLVKLTEAVVFDLYKH---PACLPFQDERSSDSFIAV-GWGSTGLALKPSAQLLKVKL 219

  Fly   421 VYENRYYCQDKIS--------FFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGI 477
            .....:.|:..::        .|...:|:|......:|:|.|||||||:: .:.:|..:..:.||
  Fly   220 QRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLM-YHREYPCMYVVVGI 283

  Fly   478 VSYGSENCGDRK-PGVYTKTGAFFSWIKANL 507
            .|.|. :||... ||:||:...:..||...|
  Fly   284 TSAGL-SCGSPGIPGIYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 81/265 (31%)
Tryp_SPc 260..503 CDD:214473 79/262 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/268 (30%)
Tryp_SPc 68..309 CDD:214473 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.