DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG4815

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:102/246 - (41%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 IYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFT--G 337
            ::..|:|.     ||.:|:..|::||||||            ...:...:..:......:||  |
  Fly    53 LFNGRKLV-----CSATLLTPRHILTAAHC------------FENLNRSKFHVIGGKSAEFTWHG 100

  Fly   338 NCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVR-----YTHEILPICVPKDPIPLHNH 397
            |   .|.:..:....:|.:|.. .:|.:|:|:.:.:.|:|     |......:..|:|       
  Fly   101 N---NFNKNKLIRVQIHPKYAK-MKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRD------- 154

  Fly   398 PLQIAGWGY-----TKNREYSQVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSG 457
            .|..||||:     .::|:.:...:...:...| .|:.::......:.|||.....:..|.||||
  Fly   155 KLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKR-DCEKQLDRKMPPNIICAGAYNNKTLCFGDSG 218

  Fly   458 GPLMLTLNNDYQDIVYLAGIVSYGSENCG-DRKPGVYTKTGAFFSWIKANL 507
            |||:|...        :.||.:: :..|| :.||.||.....:..:||..:
  Fly   219 GPLLLGRQ--------VCGINTW-TFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 57/243 (23%)
Tryp_SPc 260..503 CDD:214473 55/240 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 57/243 (23%)
Trypsin 49..256 CDD:278516 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.