DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG16710

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:359 Identity:152/359 - (42%)
Similarity:195/359 - (54%) Gaps:49/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KQEFPDCPADEKCIRLDKC------LRIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYICCPEP 240
            :.|:|.|..|||||.|.:|      |:.||.|..:.| :.::|.|....:..:...|..||||..
  Fly    24 ESEYPPCNLDEKCISLARCTSLLPFLKPHNMTPAEKA-VFEDRYCGYGPKGQELLDRVLICCPNM 87

  Fly   241 GNVLPTS--CGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLST----MTNNCSGSLINKRYVL 299
            |::||.:  ||...|.||:..|...:|||.||||:::|.:|..|.    :.:.|:||||..||||
  Fly    88 GHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVL 152

  Fly   300 TAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDC--DFTG--NCAAPFVEIGIEYFNVHEQYFNT 360
            |||||     :..|.|.|||||||||:|.:||||  ...|  :||...:||.::....|..|.  
  Fly   153 TAAHC-----LRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYM-- 210

  Fly   361 SRFE----SDIALVRLQTPVRYTHEILPICVPKDPI----PLHNHPLQIAGWGYTKNREYSQVLL 417
             .||    :||||:||:.|||||.:|.||||..|.|    ...||.|||||||.:..:.||.|||
  Fly   211 -VFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLL 274

  Fly   418 HNTVY-ENRYYCQ--------DKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVY 473
            ...|. .|...|.        ||      |:.|||..:.|.|:|:||||||||..:....::.||
  Fly   275 QAYVNGRNADECSLSEPSLGLDK------ETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVY 333

  Fly   474 LAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANL 507
            ||||.|||...|| ..|..||||..|..||..|:
  Fly   334 LAGITSYGYSQCG-YGPAAYTKTSKFVEWILWNM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 121/270 (45%)
Tryp_SPc 260..503 CDD:214473 119/267 (45%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 14/49 (29%)
Tryp_SPc 105..362 CDD:214473 120/271 (44%)
Tryp_SPc 106..362 CDD:238113 119/270 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463196
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.