DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG31219

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:340 Identity:158/340 - (46%)
Similarity:198/340 - (58%) Gaps:35/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DCPADEKCIRLDKCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDK----RHYICCPEPGNVLPTS 247
            ||...||.:.|.:|..::  |......||         |..|.|.    ...||||.|||.||::
  Fly    24 DCYPGEKYVYLYECPHVY--TAGRSRTLM---------REYDMDAWLLFGQRICCPPPGNRLPST 77

  Fly   248 --CGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKM 310
              |||:...|||..|:.||||.|||||||:|.|.....:...|:|||||.|||||:||||   ..
  Fly    78 EICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV---NG 139

  Fly   311 VNTDLVLRRVRLGEHDIT----TNPDC-DFTGNCAAPFVEIGIEYFNVHEQYFNTS--RFESDIA 368
            :..||.|:.|||||||||    .|||| |....||.|.:||.:|...||..:.:.|  ..|.|||
  Fly   140 IPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIA 204

  Fly   369 LVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENRY-YCQDKI 432
            |:||:.||||...|:|||:||... .....|:|||||.|...::||||:|..:.|... .|..:.
  Fly   205 LLRLKMPVRYRTGIMPICIPKHGF-FAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRF 268

  Fly   433 SFF-RNES-QICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGD-RKPGVYT 494
            .:. .|:| ||||.|..|.|:|:||||||||:|::|   ..||||||.:|||:|||. ..||:||
  Fly   269 PYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDN---SSVYLAGITTYGSKNCGQIGIPGIYT 330

  Fly   495 KTGAFFSWIKANLKP 509
            :|.||..||||.|:|
  Fly   331 RTSAFLPWIKAVLRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 128/256 (50%)
Tryp_SPc 260..503 CDD:214473 125/253 (49%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 127/257 (49%)
Tryp_SPc 90..342 CDD:238113 128/258 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463183
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.