DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG5246

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:119/295 - (40%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 QCAIDTRRIDSDKRHYICCPEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLST 283
            ||:..:.:|  .:||.         |....|...|..|:..|..:.....|:...:      ::|
  Fly    15 QCSAKSVKI--HRRHQ---------LNHHLGHVKPETRVIGGVDSPTGFAPYQVSI------MNT 62

  Fly   284 MTNN-CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIG 347
            ...: |.||:|..:::||||||      :...:...::..|..|.|            .|..|..
  Fly    63 FGEHVCGGSIIAPQWILTAAHC------MEWPIQYLKIVTGTVDYT------------RPGAEYL 109

  Fly   348 IEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPI-CVPKDPIPLHNHPLQIAGWGYTK--N 409
            ::...:|..: :...:.:||||:....|:.|.....|| ...|..:|.....|.:.|||.||  .
  Fly   110 VDGSKIHCSH-DKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWG 173

  Fly   410 REYSQVLLHNTVYENRYYCQDKISFFRN-----ESQICASGIRGEDSCEGDSGGPLMLTLNNDYQ 469
            |..:|:...:..|.:...||.::   ||     |..:|.....||.||.|||||||:     |..
  Fly   174 RYSTQLQKIDLNYIDHDNCQSRV---RNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-----DAN 230

  Fly   470 DIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504
            ..  |.|:|::| |.|....|.|:.....:..||:
  Fly   231 QT--LVGVVNWG-EACAIGYPDVFGSVAYYHDWIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 66/254 (26%)
Tryp_SPc 260..503 CDD:214473 64/251 (25%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/255 (25%)
Tryp_SPc 42..263 CDD:238113 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.