DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG17475

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:234 Identity:66/234 - (28%)
Similarity:104/234 - (44%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLG--EHDITTNPDCDFTGNCAAPFVEIGIEY 350
            |.|.:|::|:||||||||     ...:....||..|  |::   .||       |..|||   |:
  Fly    76 CGGCIIDERHVLTAAHCV-----YGYNPTYLRVITGTVEYE---KPD-------AVYFVE---EH 122

  Fly   351 FNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAGWGYTK------- 408
            : :|..| |:..:.:||||:||...:::.....|..:|..|: .:...|.:.|||.|:       
  Fly   123 W-IHCNY-NSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPV-ANGTQLLLTGWGSTELWGDTPD 184

  Fly   409 --NREYSQVLLHNTVYENRYYCQDKISFFRNE-----SQICASGIRGEDSCEGDSGGPLMLTLNN 466
              .:.|    |.:.||..   ||:   ...|:     ..||.....|:.:|.|||||||      
  Fly   185 ILQKAY----LTHVVYST---CQE---IMNNDPSNGPCHICTLTTGGQGACHGDSGGPL------ 233

  Fly   467 DYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKA 505
            .:..::|  |:|::|.. |....|..:.....:..||::
  Fly   234 THNGVLY--GLVNWGYP-CALGVPDSHANVYYYLEWIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 66/234 (28%)
Tryp_SPc 260..503 CDD:214473 64/230 (28%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 64/230 (28%)
Tryp_SPc 50..269 CDD:238113 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.