DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG17477

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:92/235 - (39%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LSTMTNN--CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPF 343
            |.|:..:  |.|::|:.|:::||.|||.........:....:|..|......||..:        
  Fly    44 LQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIY-------- 100

  Fly   344 VEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAGWG--Y 406
                     :|..| ::.::::||.|:.|...:.:......:.:|..|.|.....|...|||  .
  Fly   101 ---------LHCNY-DSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQS 155

  Fly   407 TKNREYSQVLLHNTVYENRYYCQDKISFFRN----ESQICASGIRGEDSCEGDSGGPLMLTLNND 467
            ......||:......:.|...|:..:|.:.:    ...|||.......:|.|||||||:      
  Fly   156 AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV------ 214

  Fly   468 YQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANL 507
            :|..  |.||::: ...|....|.::.....:..|::..:
  Fly   215 HQGT--LVGILNF-FVPCAQGVPDIFMNIMYYRDWMRQTM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 51/232 (22%)
Tryp_SPc 260..503 CDD:214473 50/229 (22%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 51/232 (22%)
Tryp_SPc 27..246 CDD:214473 50/228 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.