DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and modSP

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:88/252 - (34%) Gaps:85/252 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 CGQ-APPLYRMAYGTAARPNE-YPW-MAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKD- 308
            ||| |.|:.:.:.|.....|. .|| :.:.::.|.:  .....|.|||:....|:||||||..: 
  Fly   358 CGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEK--DYHFQCGGSLLTPDLVITAAHCVYDEG 420

  Fly   309 ----KMVNTDLVL-----------------RRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFN 352
                ...:|..|:                 |.|||                     :||...|..
  Fly   421 TRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRL---------------------IEIAPGYKG 464

  Fly   353 VHEQYFNTSRFESDIALVRLQTPVRYTHEILPICV------PKDPIPLHNHPLQ--IAGWGYTKN 409
            ..|.|:      .|:||:.|..|...:|.|.||||      .|:.:   ...:|  .|||.....
  Fly   465 RTENYY------QDLALLTLDEPFELSHVIRPICVTFASFAEKESV---TDDVQGKFAGWNIENK 520

  Fly   410 REYSQVLLHNTVYENRYYCQ--------DKISFFRNESQICASGIRGEDSCEGDSGG 458
            .|...|   ..|.::...|:        ||...|.....:         :|:|||||
  Fly   521 HELQFV---PAVSKSNSVCRRNLRDIQADKFCIFTQGKSL---------ACQGDSGG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 56/239 (23%)
Tryp_SPc 260..503 CDD:214473 56/239 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 56/239 (23%)
Tryp_SPc 371..591 CDD:304450 56/239 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.