DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and ea

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:359 Identity:124/359 - (34%)
Similarity:173/359 - (48%) Gaps:58/359 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 CIRLDKCLRIH----NTTMEDGANL-MDNRQCAIDTRRIDSDKRHYICCPE-------------P 240
            ||.|:.|..::    .|.:.|...| :...||.....::      .||||:             .
  Fly    47 CIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGYTNGKV------LICCPDRYRESSSETTPPPK 105

  Fly   241 GNV-------LPTSCGQAPPLYRMAY-GTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRY 297
            .||       ||..||..  |....| |...:.:|:||||::.| .:......::|.||||:.||
  Fly   106 PNVTSNSLLPLPGQCGNI--LSNRIYGGMKTKIDEFPWMALIEY-TKSQGKKGHHCGGSLISTRY 167

  Fly   298 VLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDC--DFTG--NCAAPFVEIGIEYFNVHEQYF 358
            |:||:|| |..|.:.||..|..|||||.|..|||||  |..|  :||.|.:::.:|....|..|.
  Fly   168 VITASHC-VNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYI 231

  Fly   359 NTSRFE-SDIALVRLQTPVRYTHEILPICVPKDPIPLHNH-----PLQIAGWGYTKNREYSQVLL 417
            ..|:.: :||||:||...|.||..:.|||:|.| :.|.:.     .:.:||||.|:....|.:.|
  Fly   232 PASKNQVNDIALLRLAQQVEYTDFVRPICLPLD-VNLRSATFDGITMDVAGWGKTEQLSASNLKL 295

  Fly   418 HNTV-------YENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLA 475
            ...|       .:|.|..||   ....::|:||.|..|.|||.|||||||:....|......:||
  Fly   296 KAAVEGFRMDECQNVYSSQD---ILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLA 357

  Fly   476 GIVSYGSENCG-DRKPGVYTKTGAFFSWIKANLK 508
            |:||:|...|| ...|||||..|.:..||:..::
  Fly   358 GVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 103/263 (39%)
Tryp_SPc 260..503 CDD:214473 101/260 (39%)
eaNP_524362.2 CLIP 37..89 CDD:288855 10/47 (21%)
Tryp_SPc 127..386 CDD:214473 102/264 (39%)
Tryp_SPc 128..389 CDD:238113 104/266 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.