DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG9649

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:290 Identity:82/290 - (28%)
Similarity:125/290 - (43%) Gaps:43/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PEPGNVLPTSCG-----QAPPLYRMAYGTAARPNEYPWMAMLI-YENRRLSTMTNNCSGSLINKR 296
            |:....|...||     |.|.::.   |......:.||||.|. :..|..:.:   |.|:||:.|
  Fly   236 PQTIGQLSGICGREKVIQTPFIHN---GIEVERGQLPWMAALFEHVGRDYNFL---CGGTLISAR 294

  Fly   297 YVLTAAHCVVKDKMVNTDLVLRR--VRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFN 359
            .|::||||.   :..:.:|...|  |.||.:.:    |...:|      ..:|:....:||||..
  Fly   295 TVISAAHCF---RFGSRNLPGERTIVSLGRNSL----DLFSSG------ATLGVARLLIHEQYNP 346

  Fly   360 TSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLH---NHPLQIAGWGYTK--NREYSQVLLHN 419
            ....::|:||::|...|.....|.|||:..:...|.   .|...:||||..:  ||......:.:
  Fly   347 NVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTD 411

  Fly   420 TVYENRYYCQDKIS----FFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSY 480
            |....::.|:..:|    .|.....||||..:....|.|||||.|||    ..|||..|.|:||.
  Fly   412 TDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLML----QEQDIWMLRGVVSA 472

  Fly   481 G---SENCGDRKPGVYTKTGAFFSWIKANL 507
            |   :..|....|.:||.......|:.:::
  Fly   473 GQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 76/260 (29%)
Tryp_SPc 260..503 CDD:214473 75/257 (29%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 75/263 (29%)
Tryp_SPc 259..497 CDD:214473 75/260 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.