DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG8870

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:331 Identity:133/331 - (40%)
Similarity:179/331 - (54%) Gaps:24/331 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 CPADEKCIRLDKCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYICCPEPGNVLP-TSCGQA 251
            |..|.:|:.||||.|..       |.:..:|:..|..||..::|   :|||:....|| .:|||:
  Fly    26 CQFDTECVNLDKCPRTR-------AVMNSSRKNIIGLRRCGTNK---VCCPKWETYLPHDTCGQS 80

  Fly   252 PPLYRMAYGTAARPNEYPWMAMLIYENR-RLS-TMTNNCSGSLINKRYVLTAAHCVVKDKMVNTD 314
              ..:...|.....||:||||||:|.|: .|| .:...|.|||||..|||||||| |:...::..
  Fly    81 --RRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHC-VEYPFMDYP 142

  Fly   315 LVLRRVRLGEHDITTNPDCDFTG---NCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPV 376
            ..|:.||||||:.:||||.....   ..|..::||.::....|||:....|..:|||||||:.||
  Fly   143 YALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPV 207

  Fly   377 RYTHEILPICVPK-DPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENR-YYCQDKISFFRNES 439
            |||..|.|||:|: ..:..|....|.:||........|:|||.:.:.|.. ..|:.... |...|
  Fly   208 RYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYD-FNLGS 271

  Fly   440 QICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDR--KPGVYTKTGAFFSW 502
            ||||.|:.|.|:..||||||||.|:......:.|.|||:|||.:.|..:  ||..||||..||.|
  Fly   272 QICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEW 336

  Fly   503 IKANLK 508
            ||:.|:
  Fly   337 IKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 110/254 (43%)
Tryp_SPc 260..503 CDD:214473 107/251 (43%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 109/248 (44%)
Tryp_SPc 93..337 CDD:214473 106/245 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.