DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Sp7

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:402 Identity:129/402 - (32%)
Similarity:181/402 - (45%) Gaps:75/402 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PFLKLKRKKAQNILMSRQCGINTYCCPKQEFPDCPADEKCIRLDKCLRIHNTTMEDGANLMDNRQ 219
            ||..|     ||:.....|.     .|.|:...|.:...|..|...::....:.|| ...:.|.|
  Fly    18 PFTVL-----QNVAAQGSCR-----NPNQKQGQCLSIYDCQSLLSVIQQSYVSPED-RTFLRNSQ 71

  Fly   220 CAIDTRRIDS-DKRHYICC---------------PEP----------------GNVLPT--SCGQ 250
            |      :|. .::.|:||               |.|                ||:||:  .||.
  Fly    72 C------LDGVGRQPYVCCTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCGP 130

  Fly   251 APPLYRMAYGTAARPNEYPWMAMLIY-ENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTD 314
            .....::..|.....:|:.|||:|.| :||....:  :|.|||||.||||||||||:  ..|.|:
  Fly   131 HSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRREL--SCGGSLINNRYVLTAAHCVI--GAVETE 191

  Fly   315 L-VLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQY--FNTSRFESDIALVRLQTPV 376
            : .|..|||||:|.:.:.|| ....|..|.:::|||...||.||  .|.:|.. ||||:||..||
  Fly   192 VGHLTTVRLGEYDTSKDVDC-IDDICNQPILQLGIEQATVHPQYDPANKNRIH-DIALLRLDRPV 254

  Fly   377 RYTHEILPICVPKDPIPL---HNHPLQIAGWGYTKNREYSQVLLHNTVYENRY-YCQDKISFFRN 437
            .....|.|:|:|.....:   ....|.::|||.|.....|.:.....:..|.: ||..|.: .||
  Fly   255 VLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYCARKFA-TRN 318

  Fly   438 ----ESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCG-DRKPGVYTKTG 497
                .||:|..|....|||:||||||||   ...:....|..|:||:|: .|| :..|||||:..
  Fly   319 IHLISSQLCVGGEFYRDSCDGDSGGPLM---RRGFDQAWYQEGVVSFGN-RCGLEGWPGVYTRVA 379

  Fly   498 AFFSWIKANLKP 509
            .:..||...::|
  Fly   380 DYMDWIVETIRP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 100/258 (39%)
Tryp_SPc 260..503 CDD:214473 98/255 (38%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855 13/64 (20%)
Tryp_SPc 136..385 CDD:214473 98/259 (38%)
Tryp_SPc 137..388 CDD:238113 100/261 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.