DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and MP1

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:397 Identity:132/397 - (33%)
Similarity:194/397 - (48%) Gaps:80/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NTYCCPKQEFPDCPADEK----CIRLDKC------LRIHNTTMEDGANLMDNRQCAIDTRRIDSD 230
            :||.  ::.|..|...::    ||.|.:|      |:....|.:| ...:...||.....::  .
  Fly    19 STYA--QEIFGYCRTPDENSGTCINLRECGYLFELLQSEEVTEQD-RRFLQASQCGYRNGQV--L 78

  Fly   231 KRHY------ICC---------PEPGN-----------------VLP--TSCGQAPPLY--RMAY 259
            ::|:      |||         |:.||                 :||  .:||:.   :  |:..
  Fly    79 EKHFCFTNVQICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCGEN---FGDRVVG 140

  Fly   260 GTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGE 324
            |......|:||||::.| .:..:...::|.|||||.||||||||||   ..:.:|..|..|||||
  Fly   141 GNETTKREFPWMALIEY-TKPGNVKGHHCGGSLINHRYVLTAAHCV---SAIPSDWELTGVRLGE 201

  Fly   325 HDITTNPDCDFTGN----CAAPFVEIGIEYFNVHEQYFNTSRFE-SDIALVRLQTPVRYTHEILP 384
            .|.:|||||....|    |..|:|:..:|....|.||...||.: :||||:||:..|:|:..|||
  Fly   202 WDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILP 266

  Fly   385 ICVPKDPIPLHNH-----PLQIAGWGYTKNREYSQVLLH---NTV----YENRYYCQDKISFFRN 437
            :|:| .....||:     .:.:||||.|:....|.:.|.   :||    ...||..|.:..   .
  Fly   267 VCLP-TLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTV---T 327

  Fly   438 ESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRK-PGVYTKTGAFFS 501
            ..|:||.|:.|.|||.|||||||:|...::.....|:||:||||...||.:. |||||:..|:.:
  Fly   328 TKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLN 392

  Fly   502 WIKANLK 508
            ||:.|::
  Fly   393 WIENNVR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 106/263 (40%)
Tryp_SPc 260..503 CDD:214473 104/260 (40%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 12/64 (19%)
Tryp_SPc 137..394 CDD:214473 105/264 (40%)
Tryp_SPc 138..397 CDD:238113 106/266 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463213
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.