DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon74E

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:119/260 - (45%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320
            |:|.|..||.|::|:...|..|..  :.|...|..|||:.||:|||||||  :|.|.....|..|
  Fly    31 RIAGGELARANQFPYQVGLSIEEP--NDMYCWCGASLISDRYLLTAAHCV--EKAVAITYYLGGV 91

  Fly   321 -RLGEHDI--TTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEI 382
             ||....:  :|||:                  .::|..: |....|:|||||||.........|
  Fly    92 LRLAPRQLIRSTNPE------------------VHLHPDW-NCQSLENDIALVRLPEDALLCDSI 137

  Fly   383 LPICVPKDPIPLHNH---PLQIAGWGYTKNREYSQVLLHNTVYENRYY-----CQDKISFFRNES 439
            .||.:|......:::   |...:|||  :..:.|..:..|..|..|:.     |:...:..: .:
  Fly   138 RPIRLPGLSSSRNSYDYVPAIASGWG--RMNDESTAISDNLRYVYRFVESNEDCEYSYANIK-PT 199

  Fly   440 QICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSEN-CGDRKPGVYTKTGAFFSWI 503
            .||.....|:.:|.|||||||:  .::..|:...|.|:.|||.:: |....|.|:|:..|:..||
  Fly   200 NICMDTTGGKSTCTGDSGGPLV--YSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

  Fly   504  503
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 77/256 (30%)
Tryp_SPc 260..503 CDD:214473 75/254 (30%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.