DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG11529

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:120/281 - (42%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 YRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCV-------------- 305
            |.:......|..::|:..|||  .::|......|.|:|::||::|||.||.              
  Fly    28 YAVGQSKYGRIEKFPYQVMLI--GKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKS 90

  Fly   306 VKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALV 370
            |:|..|:..||||..:                             |.|||: ||.....:|||||
  Fly    91 VEDTEVSGGLVLRSNK-----------------------------FIVHER-FNPETAANDIALV 125

  Fly   371 RLQTPVRYTHEILPICVPKDPIPLHNH------PLQIAGWG------YTKNREYSQV-LLHNTVY 422
            :|...|.:|..|.|..:|.    .:.|      .:..:|||      .:.:.:|::: ::.|...
  Fly   126 KLPQDVAFTPRIQPASLPS----RYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAEC 186

  Fly   423 ENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYG-SENCG 486
            ...|   |.::    ...|||.|::.|..|.|||||||:|      :|...:.||.|:| ::.|.
  Fly   187 AQEY---DVVT----SGVICAKGLKDETVCTGDSGGPLVL------KDTQIVVGITSFGPADGCE 238

  Fly   487 DRKPGVYTKTGAFFSWIKANL 507
            ...||.:|:...:..||::.:
  Fly   239 TNIPGGFTRVTHYLDWIESKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 73/273 (27%)
Tryp_SPc 260..503 CDD:214473 71/270 (26%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/269 (27%)
Tryp_SPc 37..255 CDD:214473 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.