DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG8329

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:96/260 - (36%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NEYPWMAMLIYENR---RLSTMTNNCS---GSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGE 324
            |.||     .||.:   .:....||.:   ||:|...:|||||||:..|. |.......|...|:
  Fly    37 NGYP-----AYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDS-VTIHYGSNRAWNGQ 95

  Fly   325 HDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTP-VRYTHEILPICVP 388
            ...|.|.:                .:|. |..|.|::  ..||.|:|  || |.:|:.|..:.:|
  Fly    96 LQHTVNKN----------------NFFR-HPGYPNSA--GHDIGLIR--TPYVSFTNLINKVSLP 139

  Fly   389 K---DPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENRYYCQDKISFFRN-----------ES 439
            |   ......|......|||...|...:..|          .|.| :....|           .:
  Fly   140 KFSQKGERFENWWCVACGWGGMANGGLADWL----------QCMD-VQVISNGECARSYGSVAST 193

  Fly   440 QICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504
            .:|.....|:..|.|||||.| :|.:|..|     .|::::.|..| ...|..||:......||:
  Fly   194 DMCTRATDGKSVCGGDSGGAL-VTHDNPIQ-----VGVITFASIGC-KSGPSGYTRVSDHLDWIR 251

  Fly   505  504
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/260 (26%)
Tryp_SPc 260..503 CDD:214473 65/257 (25%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 67/260 (26%)
Tryp_SPc 35..250 CDD:214473 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.