DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG3088

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:303 Identity:61/303 - (20%)
Similarity:102/303 - (33%) Gaps:101/303 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RRIDSDKRHYICCPEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCS 289
            ::...|..|.|.     |..|...||||.:..||:|     ....|                 ||
  Fly    19 KKDSEDPDHIIT-----NGSPAYEGQAPYVVGMAFG-----QSNIW-----------------CS 56

  Fly   290 GSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVH 354
            |::|...::||:|.|:.....|.......|:...:..:|.......|||                
  Fly    57 GTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGN---------------- 105

  Fly   355 EQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHP-------LQIAGWGYTKNREY 412
                      ..:||||:.. |.:::.:..:.:|.    |.|..       ..:.|||.|   .:
  Fly   106 ----------QHLALVRVPR-VGFSNRVNRVALPS----LRNRSQRYENWWANVCGWGVT---TF 152

  Fly   413 S------------QVLLHNTVYENRYYCQDKISFFR----NESQICASGIRGEDSCEGDSGGPLM 461
            |            |::.:|          :.|:|:.    ::..:|.....|..:|.||:|.||:
  Fly   153 SNGLTDALQCVDLQIMSNN----------ECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLI 207

  Fly   462 LTLNNDYQDIVYLAGIVSY-GSENCGDRKPGVYTKTGAFFSWI 503
            ..     ||.. :.||.:: .|..|....|..:.:..:...||
  Fly   208 TK-----QDST-VVGISAFVASNGCTLGLPAGFARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 50/268 (19%)
Tryp_SPc 260..503 CDD:214473 48/266 (18%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 59/293 (20%)
Tryp_SPc 29..244 CDD:214473 57/291 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.