DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:280 Identity:68/280 - (24%)
Similarity:106/280 - (37%) Gaps:83/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 NVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVV 306
            |..|...|:||  |.:..|.:.     .|.                |.||:|:..:||||.||:.
  Fly    39 NGYPAEEGKAP--YTVGLGFSG-----GWW----------------CGGSIISNEWVLTAEHCIG 80

  Fly   307 KDKMVNTDLVLRRVRLGEHDITTNPDCDFT-----GNCAAPFVEIGIEYFNVHEQYFNTSRFESD 366
            .|.:.        |..|   .|...:..||     ||    |:..|                .:|
  Fly    81 GDAVT--------VYFG---ATWRTNAQFTHWVGSGN----FITHG----------------SAD 114

  Fly   367 IALVRLQTPVRYTHEILPICVP--KDPIPLHNHPLQIA-GWGYTKN----REYSQV----LLHNT 420
            |||:|: ..|.:.|.:..:.:|  .|....:|....:| |||.|.:    .:|.|.    ::||:
  Fly   115 IALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNS 178

  Fly   421 VYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS-EN 484
            ...: ||....:    .::.||...:.|:.:|.|||||||:.      .|...|.|:.::.| ..
  Fly   179 ECAS-YYGTGTV----GDNIICVRVVDGKGTCGGDSGGPLVT------HDGSKLVGVTNWVSGAG 232

  Fly   485 CGDRKPGVYTKTGAFFSWIK 504
            |....|..:.:......||:
  Fly   233 CQAGHPAGFQRVTYHLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 62/262 (24%)
Tryp_SPc 260..503 CDD:214473 60/259 (23%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 66/277 (24%)
Tryp_SPc 37..254 CDD:238113 68/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.