DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG33460

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:269 Identity:64/269 - (23%)
Similarity:109/269 - (40%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 NVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVV 306
            |.|...||    |.|..:.|:..    ||.|:|..:....      |:|:||...::||||.|:.
  Fly    25 NYLYEQCG----LMREEFSTSLG----PWTALLHTDGSIF------CAGTLITDVFILTAASCIR 75

  Fly   307 KDKMVNTDLVLRRVRLGEHDITTN--PDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIAL 369
            .:.:        :|||||.....|  |:...            :.||.:: :.||.....::|.|
  Fly    76 PNAV--------KVRLGEFGRYPNELPEDHL------------VHYFLMY-RLFNNESLANNIGL 119

  Fly   370 VRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAG--WGYTKNREYSQVLLHNTVYENRYYCQDKI 432
            ::|...|:.|..|:|:|:..:|.......::..|  |....|...::.|....:......|.:..
  Fly   120 LKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLD 184

  Fly   433 SFFRNESQICASGIRGEDSCEGDSGGPLMLTLN--NDYQDIVYLAGIVSYGSENCGDRKPGVYTK 495
            .:    :|.||.......||:|.:|..|:....  |.|:.|.:  ||.:....:|.:.:.  ||.
  Fly   185 LY----TQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQF--GIATVNDMDCEESQG--YTD 241

  Fly   496 TGAFFSWIK 504
            ...|:.||:
  Fly   242 VLKFYWWIQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 58/251 (23%)
Tryp_SPc 260..503 CDD:214473 56/248 (23%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 57/242 (24%)
Tryp_SPc 44..249 CDD:214473 55/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.