DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG33465

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:258 Identity:73/258 - (28%)
Similarity:106/258 - (41%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDC 333
            ||||. ||:|.:..     |.|:|::|.:|||||.|:.||..:                      
  Fly    46 PWMAS-IYKNNQFI-----CDGTLVHKLFVLTAASCISKDSQL---------------------- 82

  Fly   334 DFTGNCAAPFVEIGI--------EYFNVHEQY----------FNTSRFESDIALVRLQTPVRYTH 380
                     :|..|:        ::|| :|||          |..:...:||.|:||...|.:..
  Fly    83 ---------YVLFGMYNQYRDASQFFN-NEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYA 137

  Fly   381 EILPICVPKDPIPLHNHPLQ-IAGWGYTKNREYSQVLLHNTVY---ENRYYCQDKISFFR-NESQ 440
            .|.|||:..|.: :.:.|.: ..|:|:.:....:...:..|||   :..:.|........ ||.|
  Fly   138 HIRPICIILDHV-VKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQ 201

  Fly   441 ICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWI 503
            .|| |.|....|..:||.||........::|....|:||||||.|.  ...|||...||..||
  Fly   202 FCA-GNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCS--PTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 73/258 (28%)
Tryp_SPc 260..503 CDD:214473 71/256 (28%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 73/258 (28%)
Tryp_SPc 46..261 CDD:214473 71/256 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463664
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.