DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and sphinx2

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:275 Identity:56/275 - (20%)
Similarity:103/275 - (37%) Gaps:79/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320
            |:..|..|:|....::..::|....||::... :|::|:.:::||....:: .|.:......:|.
  Fly    25 RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-AGTIISNQWILTVKEVLI-FKYIEAHFGSKRA 87

  Fly   321 RLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALV------------RLQ 373
            ..| :||                :.|..|.|..|   ::.:|.   ||||            |::
  Fly    88 FWG-YDI----------------LRIYRENFYFH---YDKTRI---IALVKCPYQKFDRRMSRVR 129

  Fly   374 TPV------RYTHEILPICVPKDPIPLHNHPLQIAGWGYTKNR-------EYSQVLLHNTVYENR 425
            .|.      ||...:..:|                |||..|.:       ...:|.:.|.....:
  Fly   130 VPAYGARFERYVGNMTMVC----------------GWGTDKRKVRLPTWMRCVEVEVMNNTECAK 178

  Fly   426 YYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLM-LTLNNDYQDIVYLAGIVSYGSENCGDRK 489
            |:  ..:.::    ::|.||...:..||||.||.:: :..|..:..|::|.      ..||....
  Fly   179 YH--TPLKWY----EMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLM------PTNCSIGY 231

  Fly   490 PGVYTKTGAFFSWIK 504
            |.|:.:......|||
  Fly   232 PSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 55/271 (20%)
Tryp_SPc 260..503 CDD:214473 52/268 (19%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/272 (19%)
Tryp_SPc 26..248 CDD:304450 55/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.