DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG6592

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:118/258 - (45%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPW-MAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRR 319
            |:..|....|:.:|: :.||:...:.|..    |.||||:.::|:||||||        |:..|.
  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYW----CGGSLISDKHVITAAHCV--------DMAKRA 174

  Fly   320 -VRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEIL 383
             |.||.::|....:   .|...   :.:..|.|.::..: |..|.:.|||:|||...|.:...|.
  Fly   175 LVFLGANEIKNAKE---KGQVR---LMVPSENFQIYPTW-NPKRLKDDIAIVRLPHAVSFNERIH 232

  Fly   384 PICVPKDPIPLHNHPLQIA---GWG--YTKNREYSQVL--LHNTVYENRYYCQDKISFFRNESQI 441
            ||.:||......:...::|   |||  .|.....|.||  :...:.:.| .|:.........:.|
  Fly   233 PIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGR-TCKSNFPLSYRGTNI 296

  Fly   442 CASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS-ENCGDRKPGVYTKTGAFFSWI 503
            |.||.....:|.|||||||:|...:..:.:  |.||.|:|| ..|....|..:||..::..||
  Fly   297 CTSGRNARSTCNGDSGGPLVLQRRHSKKRV--LVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 76/254 (30%)
Tryp_SPc 260..503 CDD:214473 74/252 (29%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 75/256 (29%)
Tryp_SPc 123..359 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.