DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:280 Identity:70/280 - (25%)
Similarity:109/280 - (38%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 GQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNT 313
            |:|....|:..|..|...:.|::..|.:......|.   |.||:|...:|:||.||.  |.|.:.
  Fly    30 GKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW---CGGSIIGNTWVMTAKHCT--DGMESV 89

  Fly   314 DL---VLRRVR------LGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIAL 369
            .:   .|.|::      :|..|                |:|.|                ..||:|
  Fly    90 TIYYGALWRLQAQYTHWVGRSD----------------FIEHG----------------SGDISL 122

  Fly   370 VRLQTP-VRYTHEILPICVPKDPIPLHNHP---LQIAGWGYTKNR----EYSQV----LLHNTVY 422
            :|  || |.:...:..:.:|:.....:|:.   ..::|||.|.:.    ||...    :..|:|.
  Fly   123 IR--TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVC 185

  Fly   423 ENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSE-NCG 486
            ||.|.     ||  :...||......:.:|.|||||||::...|..      .||||:||. .|.
  Fly   186 ENYYG-----SF--SGDLICIPTPENKGTCSGDSGGPLVIHDGNRQ------VGIVSFGSSAGCL 237

  Fly   487 DRKPGVYTKTGAFFSWIKAN 506
            ...|....:..::..||:.|
  Fly   238 SNGPKGMVRVTSYLDWIRDN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 66/267 (25%)
Tryp_SPc 260..503 CDD:214473 64/264 (24%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 65/268 (24%)
Tryp_SPc 41..257 CDD:238113 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.