DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:277 Identity:68/277 - (24%)
Similarity:101/277 - (36%) Gaps:88/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNN-----CSGSLINKRYVLTAAHCVVKDKMVNTDL 315
            |:..|..|...:.|::..|.::|       .|     |.||:|...:|||||||..         
  Fly    36 RITNGYPAYEGKVPYIVALRFDN-------GNGGGWYCGGSIIGHEWVLTAAHCTY--------- 84

  Fly   316 VLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQ-----YFNTSRFESDIALVRLQTP 375
                                    .|.:|.  |.|..|..|     :::|....:||||:|  ||
  Fly    85 ------------------------GASYVT--ISYGAVWRQQPQFTHYDTGNLHNDIALIR--TP 121

  Fly   376 VRYTHEILPICVPKDPIPLHNHPLQ--------IAGWGYTKNREYSQVLLH--------NTVYEN 424
                |......|.|..:|.::....        ::|||.:.:.......|:        |:|   
  Fly   122 ----HVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSV--- 179

  Fly   425 RYYCQDKI-SFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS-ENCGD 487
               |.|.. |.:...:.:|.:....:.||.|||||||:|...|..      .||||:|| ..|..
  Fly   180 ---CLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQ------VGIVSFGSAAGCLS 235

  Fly   488 RKPGVYTKTGAFFSWIK 504
            ..|...|:...:..||:
  Fly   236 NSPKGLTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/273 (25%)
Tryp_SPc 260..503 CDD:214473 65/270 (24%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 66/274 (24%)
Tryp_SPc 37..254 CDD:238113 67/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.