DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:110/263 - (41%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320
            |:..|..|...::|:...|.:.:...|..   |.||:|:..:|||||||......|.       :
  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSWW---CGGSIIDNTWVLTAAHCTSGASAVT-------I 93

  Fly   321 RLGEHDITTNPDCDFTGNCAAPFVE-IGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILP 384
            ..|.           |...:|..|: :..:.|..|..| |:....:||:|::..| |.:|..|..
  Fly    94 YYGA-----------TVRTSAQLVQTVSADNFVQHASY-NSIVLRNDISLIKTPT-VAFTALINK 145

  Fly   385 ICVPKDPIPLHNHPLQIA---GWGYTKNREYSQVLLHNTV-YE-----NRYYCQDKI-SFFRNES 439
            :.:|........:..|.|   |||.|.:   |...:.||: ||     :...||:.. |.....:
  Fly   146 VELPAIAGTYSTYTGQQAIASGWGKTSD---SATSVANTLQYEVFEVVSVSQCQNTYGSLVATNN 207

  Fly   440 QICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSY-GSENCGDRKPGVYTKTGAFFSWI 503
            .||.:......:|.|||||||:|..::.      |.|:.|: .|..|....|..:|:..::..||
  Fly   208 VICVATPNKVSTCNGDSGGPLVLVSDSK------LIGVTSFVSSAGCESGAPAGFTRVTSYLDWI 266

  Fly   504 KAN 506
            |.|
  Fly   267 KTN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 68/257 (26%)
Tryp_SPc 260..503 CDD:214473 65/254 (26%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 66/258 (26%)
Tryp_SPc 40..269 CDD:238113 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.