DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG15873

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:184 Identity:48/184 - (26%)
Similarity:84/184 - (45%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 CSGSLINKRYVLTAAHCVVKDKMVNTD-----LVLRRV-RLGEHDITTNPDCDFTGNCAAPFVEI 346
            |||.|::.|.|||||||:......:.:     :|...: ||..:|     :.||.          
  Fly    69 CSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYD-----ESDFR---------- 118

  Fly   347 GIEYFNVHEQYFNTSRF-ESDIALVRLQTPVRYT-HEILPICVPKDPIPLHNHPLQIAGWGYT-K 408
            .::...||.:|   .|: ::|:|::||...|:.: |::||:.:.|.....:.......|||.. :
  Fly   119 SVDRLVVHPEY---ERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQ 180

  Fly   409 NREYSQVLLH-NTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLM 461
            :..||..|:: :.:......||.....|..:..:|...:....:|.||.||||:
  Fly   181 HGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 48/184 (26%)
Tryp_SPc 260..503 CDD:214473 48/184 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 48/184 (26%)
Tryp_SPc 59..250 CDD:238113 48/184 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.