DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30414

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:294 Identity:96/294 - (32%)
Similarity:136/294 - (46%) Gaps:55/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PGNVLPTSCGQAPPLY--RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAA 302
            ||::|.:|||...|.:  .:..|..|.....|||..::.|..        |.||||..|:|||||
  Fly    22 PGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLGEKL--------CGGSLITSRFVLTAA 78

  Fly   303 HCVVKDKM-------------------VNTDLVLRRVRLGEHDITTNP--DCDFTGNCAAPFVEI 346
            ||:|...|                   |.....|||:||||:| |..|  ||     |.....|:
  Fly    79 HCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD-TRFPGKDC-----CVPKSYEL 137

  Fly   347 GIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPIC------VPKDPIPLHNHPLQIAGWG 405
            .::...:|..|  ....::||.|:|:::.|:|:..:.|||      :.:.||      ..|.|||
  Fly   138 AVDRKILHADY--NLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPI------FNITGWG 194

  Fly   406 YTKNREYSQVLLHNTVYE-NRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQ 469
            .|.:...|:.|...|||. :.::|:.|.:...:||||||:| ...|:|.|||||||...:.....
  Fly   195 VTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAG-TNSDACHGDSGGPLSAQVPFAGS 258

  Fly   470 DIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWI 503
            .:.:..|:|||||..|  ....|||.......||
  Fly   259 WLTFQYGLVSYGSAAC--HSFSVYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 89/272 (33%)
Tryp_SPc 260..503 CDD:214473 87/270 (32%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 87/273 (32%)
Tryp_SPc 41..290 CDD:238113 87/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.