DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG13527

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:246 Identity:62/246 - (25%)
Similarity:96/246 - (39%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 CSGSLINKRYVLTAAHCVV-KDKMVNTDLVLRRVRLGEHDITTNPD---CDFTGNCAAPFVEIGI 348
            |.|.|::.::|:||||||: :.|::.....|..|....|.:...|.   |....:...|      
  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVP------ 120

  Fly   349 EYFNVHEQYFNTSRFESDIALVRLQTP-------VRYTHEILPICVPKDPIPLHNHPLQIAGWGY 406
            :.|.:|..:        ::||::||..       :.:.|  ||...||..|   .|  .:.||| 
  Fly   121 KNFTMHNTF--------NMALMKLQEKMPSNDPRIGFLH--LPKEAPKIGI---RH--TVLGWG- 169

  Fly   407 TKNREY------------SQVLLHNTVYENRYYCQDKISFFRN--ESQICASGIR---GEDSCEG 454
               |.|            ..||:.|.|      |:   ::||:  :..:||....   ..:.|.|
  Fly   170 ---RMYFGGPLAVHIYQVDVVLMDNAV------CK---TYFRHYGDGMMCAGNNNWTIDAEPCSG 222

  Fly   455 DSGGPLMLTLNNDYQDIVYLAGIVSYGSENCG-DRKPGVYTKTGAFFSWIK 504
            |.|.||:        ....:.|||:| ...|| ...|.|||...:...||:
  Fly   223 DIGSPLL--------SGKVVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 62/246 (25%)
Tryp_SPc 260..503 CDD:214473 60/243 (25%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/246 (25%)
Tryp_SPc 43..263 CDD:214473 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.