DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG10764

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:275 Identity:92/275 - (33%)
Similarity:129/275 - (46%) Gaps:47/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKD 308
            |.|.||.:..........||.||.. |||.:      .::....|.|::|:.|:||:||||:|: 
  Fly    26 LETPCGISTRPKISGGDDAAEPNSI-WMAAI------FNSSDFQCGGTIIHMRFVLSAAHCLVR- 82

  Fly   309 KMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQ 373
               ..||.   ||||..:| ..|        ||  |...|..|..|:  |..|.:.:||.|::|.
  Fly    83 ---GYDLY---VRLGARNI-NEP--------AA--VHTVINVFVHHD--FIASEYRNDIGLLQLS 128

  Fly   374 TPVRYTHEILPICVPKDPIPLHN----HPLQIAGWGYTKNREYSQVLLHNTVY---ENRYYCQDK 431
            ..:.||..:.|||:..||....:    ...:..|||   ||.....::..|:|   ..|..|:.|
  Fly   129 ESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG---NRNGKLSIMLQTIYLLHLKRNECKRK 190

  Fly   432 ISFFRNESQICASGIRGEDSCEGDSGGPLMLTL----NNDYQDIVYLAGIVSYGSENCGDRKPGV 492
            ::|..|..|||| |.:..|:|.|||||||...:    |..|:  |.| ||||:|...|  |..||
  Fly   191 LNFNLNSRQICA-GTKNGDTCRGDSGGPLSTNILFPSNKSYE--VQL-GIVSFGDPEC--RGVGV 249

  Fly   493 YTKTGAFFSWIKANL 507
            ||...::..||.:.:
  Fly   250 YTDVTSYVDWISSTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 88/256 (34%)
Tryp_SPc 260..503 CDD:214473 86/253 (34%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 86/258 (33%)
Tryp_SPc 38..263 CDD:238113 88/260 (34%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463521
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.