DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon44E

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:305 Identity:78/305 - (25%)
Similarity:116/305 - (38%) Gaps:100/305 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 VLPTSCGQAPPLY----------RMAYGTAARPNEYPWMAMLIYENRRLSTMTNN----CSGSLI 293
            |:|:...:|.|:.          |:..|..|...:.|::..|.:         |:    |.||:|
  Fly    17 VVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSF---------NDGGYWCGGSII 72

  Fly   294 NKRYVLTAAHCVVKDKMVNTDLV-----LRRVRLGEH-----DITTNPDC-DFTGNCAAPFVEIG 347
            :..:|||||||.   ...|..|:     .|......|     |:..:||. ||..|         
  Fly    73 DHTWVLTAAHCT---NSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNN--------- 125

  Fly   348 IEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQ--------IAGW 404
                              ||||:|:      .|......|.|..:|.:|....        .:||
  Fly   126 ------------------DIALIRI------PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGW 166

  Fly   405 GYTKNREYS---------QVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPL 460
            |.|.|....         |::.:|..  ..||..:.|:    ::.||.:...|:.||.|||||||
  Fly   167 GLTDNNSGMSNYLNCVDVQIIDNNDC--RNYYGSNYIT----DNTICINTDGGKSSCSGDSGGPL 225

  Fly   461 MLTLNNDYQDIVYLAGIVSYGS-ENCGDRKPGVYTKTGAFFSWIK 504
            :|..||      .:.||||:|| |.|...:|..:|:...:..||:
  Fly   226 VLHDNN------RIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 73/278 (26%)
Tryp_SPc 260..503 CDD:214473 71/275 (26%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/279 (26%)
Tryp_SPc 41..266 CDD:238113 73/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.