DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and try-9

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:234 Identity:55/234 - (23%)
Similarity:97/234 - (41%) Gaps:69/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 SGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGN--------------- 338
            :|:|::..:::||||.               :.:.|..:   |||| |||               
 Worm    29 TGTLVSPWHIVTAAHL---------------IGISEDPL---PDCD-TGNLREAYFVRDYKNFVA 74

  Fly   339 -----CAAP-----------FVEIGIEYFNVHEQYFNTSRFE----SDIALVRLQTPVRYTHEIL 383
                 ||.|           |..:.|:...:.:.|......:    :|||:..|:.|:.::.:|.
 Worm    75 FVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIF 139

  Fly   384 PICVPKDP-IP-LHNHPLQIAGWGYTKNREYSQVLLHNTVYENRY----YCQDKISFFRNESQIC 442
            |.|:|..| || :.....::.|:|    |:.|..:|.:...::.|    .|.|.   |......|
 Worm   140 PACLPSAPKIPRIRETGYKLFGYG----RDPSDSVLESGKLKSLYSFVAECSDD---FPYGGVYC 197

  Fly   443 ASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYG 481
            .|.:....||:||||..::.|  :|.:::..|.|::|.|
 Worm   198 TSAVNRGLSCDGDSGSGVVRT--SDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 55/234 (24%)
Tryp_SPc 260..503 CDD:214473 55/234 (24%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 55/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.