DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG9377

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:385 Identity:91/385 - (23%)
Similarity:149/385 - (38%) Gaps:100/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 NILMSRQCGINTYCCPKQE-----------FPD---CPADEKCIRLDKCLRIHNTTMEDGANLMD 216
            :|..|:.||...:|.|.::           :||   ...||.|..::||           .|:.|
  Fly    18 SIAASKVCGPEKHCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHYMEKC-----------CNIPD 71

  Fly   217 NRQCAIDTRRIDSDKRHYICCPEPGNVLPTSCGQAPPL--YRMAYG---TAARPNEYPWMAMLIY 276
            .    :.|.:|..:   .:.||         ||....|  |....|   ..|:..|:||: :.:|
  Fly    72 K----LPTPKIPEE---MMSCP---------CGGRHDLWYYLRPLGYKQQEAKFGEFPWL-VAVY 119

  Fly   277 ENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRL--GEHD--ITTNPDCDFTG 337
                 .:.|..|||:||....|:|.||||...:|       .:|||  ||.|  :...|.     
  Fly   120 -----GSDTYLCSGALITPLAVITTAHCVQNSEM-------EKVRLLAGEWDAAVELEPQ----- 167

  Fly   338 NCAAPFVEIGIEYFNVHEQYFNTSRFES-DIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQI 401
                |..:..:....||..|.......: .|.||..:.|.:....:.|||:|...|..:.....:
  Fly   168 ----PHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCYV 228

  Fly   402 AGWGYTKNREYSQVLLHNTVYENRY--------YCQDKISF-------FRNESQICASGIRGEDS 451
            :||   :..::.:.    .:...|:        .|:.|:..       ..|:|.:||.|.:|:..
  Fly   229 SGW---QRSDFGRA----AILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFV 286

  Fly   452 CEGD---SGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANLK 508
            | ||   :..|||..|:. :.|..:|||:::..:...|.:..|:||....:..||...|:
  Fly   287 C-GDVDMTAVPLMCPLSG-HDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWIDLKLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/271 (25%)
Tryp_SPc 260..503 CDD:214473 65/268 (24%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 65/265 (25%)
Tryp_SPc 105..339 CDD:214473 64/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.